logo motorshowmagazine.ru MOTORSHOWMAGAZINE.RU | Личный кабинет | Контакты | Доставка товара

Пистолет продувочный GAV 60A бс

Пневматический моющий пистолет GAV 61AC


Моющий пистолет GAV 61 АС предназначен для распыления жидкостей на водной основе, например, мыльных растворов

1570 РУБ

GAV 61ac похожие

Подробнее

Краскопульт пневматический GAV 162 А 1.5 9716

Краскопульт пневматический GAV 162 А 1.8 9717

Краскопульт пневматический GAV 162 А 1.5 9716

Пистолет продувочный GAV 60A бс

штуцер GAV ВР 1/4


Тип резьбы: ВР 1/4

117 РУБ

GAV похожие

Подробнее

Пистолет продувочный GAV GA60BRSC бс с удл. соплом

Фильтр GAV F-180


Фильтр F-180 GAV предназначен для очистки от влаги и пыли сжатого воздуха, поступающего от компрессора к пневмоинструменту.

  • Фильтр имеет выходное отверстие на 1/4 дюйма,
  • Есть возможность встроить дополнительные акссесуары: регулятор и лубрикатор.

3200 РУБ

GAV f-180 похожие

Подробнее

Пистолет для подкачки шин GAV 60G PROFI


Пистолет для подкачки шин GAV 60 широко используется в автосервисах, гаражах и автомастерских. Позволяет легко накачать автомобильные шины воздухом.

4780 РУБ

GAV 60g-profi похожие

Подробнее

Краскопульт пневматический GAV Record-2000 HP, сопло: 1.8 мм, бак: 1 л

Smk 129 gav ogup-ivces.ru

Клатч. Замечательный женский клатч. Размеры: 25*16*3 см. Цвет: синий. 1440 RUR. LacyWear SMK(214)-GAV похожие · Подробнее ...

Koffer - 219 Photos - 2 Reviews - Motor Vehicle Company

214 people follow this. About See All +7 343 310-22-07. Contact Koffer on Messenger. www.koffer.company. Motor Vehicle Company. People. 203 likes. Related Pages. Logobook design studio. Business Service. kabel-pol.com.ua. Website. ... Блок согласования Koffer SMK-02SL

<SEC-DOCUMENT>0000945934-17-000003.txt : 20170301 <SEC ...

<edgarSubmission xmlns="http://www.sec.gov/edgar/seventeenafiler" xmlns:com ="http://www.sec.gov/edgar/common"> ...... &NC#W-!.2&N)!6]+HBG_(SK ...

-----BEGIN PRIVACY-ENHANCED MESSAGE----- Proc-Type: 2001 ...

... MESSAGE----- Proc-Type: 2001,MIC-CLEAR Originator-Name: [email protected] www.sec.gov ...... SK#B+R:7YCW2K M-J)%1Y0M`CBW**\RCSBKXW9CPCUN3B .

Клатч SMK(214)-GAV - купить в интернет-магазине Lacywear.ru в ...

Клатч SMK(214)-GAV, материал искусственная кожа, страна Китай, цена 1440.00 руб. Замечательный женский клатч.Размеры: 25*16*3 смЦвет: синий ...

BLIZKO Ремонт Екатеринбург от 10.07.2014 № 27(398) by ...

Issuu is a digital publishing platform that makes it simple to publish magazines, catalogs, newspapers, books, and more online. Easily share your publications and get them in front of Issuu’s ...

SMK214.wmv - YouTube

Apr 10, 2012 · Питатель ящичный пластинчатый СМК-214. Skip navigation Sign in. Search. Loading... Close. This video is unavailable. Watch Queue ... SMK214.wmv Евгений КЕМ ...

Gun Data Codes - State of Michigan

GAV. Armand Mieg. --. MIE. Armas. --. AEI. Armas Bost. SP. BOZ. Armas Erbi. SP. ERI. Armas Gib-Maximo. SP. GIM ...... SMK. Smoker. US. IJ. Model of Iver Johnson. Smythe, John M., Mdes., (or Hdw.) Co. US. SMO. Various mfrs. ...... Page 214 ...

"Русский Север 2019" - Страница 2 - Клуб Служебного ...

183 Сука Промежуточный gav 9022 ... 214 Кобель Юниоров rbi 01236 ... smk 2 КЛАСС ЧЕМПИОНОВ / champion class 13.РКФ 4374302, dmm 4234 КЛАСС ЧЕМПИОНОВ НКП / club champion class 14., РКФ 4567011, jjg 1968

NCBI CDD Conserved Protein Domain PRK09355

Dec 9, 2010 ... ... DELKVITKMANGLLVNIGTLEPYQMESSMISMKIA 75 gi 28211402 6 .[5]. .... FI GAVS 227 gi 25028148 152 ...

Smk 120 gav teraonline-game.ru

smk 128 gav. Пистолет для подкачки шин gav 60g profi. . Бренд gav 60g profi. 3 780 руб. ... в наличии. В магазин →. Краскопульт пневматический gav 162 А 1.5 9716. . …

Smk 180 gav attestacia-abakan.ru

Доставка покупок из интернет магазина attestacia-abakan.ru осуществляется по всей территории России и стран СНГ.

Property & Casualty Code Lists

... FLO falling objects; FLV fire of vessel; FRZ freezing; GAV general average; GLS glass; GVA government ... SHC sinkhole collapse; SHS shortage/slackage; SKV sinking of the vessel; SMK smoke; STV standing of ... Coverage Code List ( 214).

Technical informaTion 2018 - Gestra

SMK 22. Virtually pocket-free. For small and medium condensate flowrates. ...... H1 211 214 220 238 243 266 290 324 348 460 479 570 606 660. GAV 36F.

Smk 15 chk teraonline-game.ru

Smk 180 gav Пневматический фильтр GAV FR-180. Фильтр-регулятор FR-180 GAV предназначен для очистки от влаги и пыли сжатого воздуха, поступающего.

Scrideli CA[au] - PubMed Result - NCBI

1: Cruzeiro GAV, Salomão KB, de Biagi CAO Jr, Baumgartner M, Sturm D, Lira RCP, ... de Paula Queiroz RG, Oba-Shinjo SM, Scrideli CA, Nagahashi SMK, Tone LG, Valera ET. ... 2018 Feb;214(2):213-216. doi: 10.1016/j.prp.2017.11.020 .

Smk 214 gav. <SEC-DOCUMENT>0000945934-17-000003.txt : 20170301 <SEC ...

<edgarSubmission xmlns="http://www.sec.gov/edgar/seventeenafiler" xmlns:com ="http://www.sec.gov/edgar/common"> ...... &NC#W-!.2&N)!6]+HBG_(SK ...

Smk 214 gav. -----BEGIN PRIVACY-ENHANCED MESSAGE----- Proc-Type: 2001 ...

... MESSAGE----- Proc-Type: 2001,MIC-CLEAR Originator-Name: [email protected] www.sec.gov ...... SK#B+R:7YCW2K M-J)%1Y0M`CBW**\RCSBKXW9CPCUN3B .

Питатель пластинчатый СМК-214 в Сибае (Дробильное ...

Питатель пластинчатый СМК-214 износ 5%, 2006г.в., в комплекте питатель, бункер 7м3, редуктор, эл ...

Стереомикроскоп Альтами СМК1865 (СМК1865-Т) купить по ...

МКАД 38 км, владение 4Б, стр.1, офис 214 +7 (495) 662-96-25: Санкт-Петербург Маршала Говорова д.35, корпус 5, литера Ж, БЦ "Терминал" 2й корпус, 3й этаж, офис 356 +7 (812) 643-23-55 Новосибирск Красный проспект 220/5, офис 320

Переходник Gav 1227/1 38904


Тип оснастки: адаптер (переходник), Назначение: для пневмоинструмента, Посадочный размер: 1/4

113 РУБ

Gav 1227-1-38904 похожие

Подробнее

Переходник Gav 1233/4 8 1/4


Тип оснастки: адаптер (переходник), Назначение: для пневмоинструмента, Посадочный размер: 1/4

101 РУБ

Gav 1233-4-8-1-4 похожие

Подробнее

Переходник Gav 1233/ 8 370/3 38964


Тип оснастки: адаптер (переходник), Назначение: для пневмоинструмента, Посадочный размер: 1/4

113 РУБ

Gav 1233-8-370-3-38964 похожие

Подробнее

Переходник Gav 47c/1 395/1 38937


Тип оснастки: адаптер (переходник), Назначение: для пневмоинструмента, Посадочный размер: 1/4

99 РУБ

Gav 47c-1-395-1-38937 похожие

Подробнее

Краскораспылитель GAV 2000 ECO 2.5 бс 26559 HP, сопло: мм, макс. 250 л/мин, бак: 1 л

Пневматический фильтр GAV FR-180


Фильтр-регулятор FR-180 GAV предназначен для очистки от влаги и пыли сжатого воздуха, поступающего от компрессора к пневмоинструменту.

  • Фильтр имеет выходное отверстие на 1/4 дюйма,
  • Есть возможность встроить дополнительные акссесуары: регулятор и лубрикатор.

4200 РУБ

GAV fr-180 похожие

Подробнее

Пистолет GAV 61В моющий бачок н б 1л + с, 244-65


Пистолет для вязких жидкостей GAV 61 B бс - предназначен для работы со всеми типами жидкости, соединение винтовое

1470 РУБ

GAV 61в-моющий-бачок-н-б-1л-бачок-б-с-244-65 похожие

Подробнее

Сопло для краскопульта GAV 2000 R 1.2


Комплект для замены насадки для моделей Record. Диаметр сопла 1.2.

2620 РУБ

GAV 2000-r-1-2 похожие

Подробнее

Переходник Gav 112 c/1 6


Тип оснастки: адаптер (переходник), Назначение: для пневмоинструмента, Посадочный размер: 1/4

395 РУБ

Gav 112-c-1-6 похожие

Подробнее

Переходник Gav Rbl/4 499/4


Тип оснастки: кран, Посадочный размер: 1/2 и 1/4

403 РУБ

Gav rbl-4-499-4 похожие

Подробнее

Переходник Gav Rbl/2 499/2


Тип оснастки: кран, Посадочный размер: 1/4

285 РУБ

Gav rbl-2-499-2 похожие

Подробнее

Комментарии



Подпишитесь на новые товары в motorshowmagazine.ru