logo motorshowmagazine.ru MOTORSHOWMAGAZINE.RU | Личный кабинет | Контакты | Доставка товара

Пистолет GAV 166 В бс пескоструйный

Краскопульт пневматический GAV 162 А 1.8 9717

Пистолет продувочный GAV GA60BRSC бс с удл. соплом

Переходник Gav Uni-c1


Тип оснастки: адаптер (переходник), Посадочный размер: 1/4

528 РУБ

Gav uni-c1 похожие

Подробнее

Манометр Gav 60fd 4166790


Тип манометра: цифровой

3471 РУБ

Gav 60fd-4166790 похожие

Подробнее

Переходник Gav 1260/4


Тип оснастки: адаптер (переходник), Посадочный размер: 1/2

542 РУБ

Gav 1260-4 похожие

Подробнее

Бачок Gav 451540


Тип оснастки: бачок, Назначение: для краскопульта, Бак: 0.5, Страна происхождения: Италия

729 РУБ

Gav 451540 похожие

Подробнее

Переходник Gav Uni-c3


Тип оснастки: адаптер (переходник), Посадочный размер: 1/4

528 РУБ

Gav uni-c3 похожие

Подробнее

Манометр Gav 60dd 4166780


Тип манометра: цифровой

4339 РУБ

Gav 60dd-4166780 похожие

Подробнее

Переходник Gav Uni-b2


Тип оснастки: адаптер (переходник), Посадочный размер: 1/4

651 РУБ

Gav uni-b2 похожие

Подробнее

Сопло Gav 1500r25


Тип оснастки: сопло, Назначение: для краскопульта, Посадочный размер: 1/4

1190 РУБ

Gav 1500r25 похожие

Подробнее

Пистолет GAV 61 В бс моющий н/б 1л

Пистолет для накачки шин Gav 24464


Тип пневмопистолета: для накачки шин, Макс. давление: 12

4653 РУБ

Gav 24464 похожие

Подробнее

Бачок Gav 31936


Тип оснастки: бачок, Назначение: для краскопульта, Бак: 0.6, Страна происхождения: Италия

729 РУБ

Gav 31936 похожие

Подробнее

Сопло Gav 1000 r 0.7


Тип оснастки: сопло, Назначение: для пневмоинструмента

1067 РУБ

Gav 1000-r-0-7 похожие

Подробнее

Smk 120 gav teraonline-game.ru

smk 128 gav. Пистолет для подкачки шин gav 60g profi. . Бренд gav 60g profi. 3 780 руб. ... в наличии. В магазин →. Краскопульт пневматический gav 162 А 1.5 9716. . …

Koffer - 219 Photos - 2 Reviews - Motor Vehicle Company

214 people follow this. About See All +7 343 310-22-07. Contact Koffer on Messenger. www.koffer.company. Motor Vehicle Company. People. 203 likes. Related Pages. Logobook design studio. Business Service. kabel-pol.com.ua. Website. ... Блок согласования Koffer SMK-02SL

Smk 180 gav attestacia-abakan.ru

Доставка покупок из интернет магазина attestacia-abakan.ru осуществляется по всей территории России и стран СНГ.

BLIZKO Ремонт Екатеринбург от 10.07.2014 № 27(398) by ...

Issuu is a digital publishing platform that makes it simple to publish magazines, catalogs, newspapers, books, and more online. Easily share your publications and get them in front of Issuu’s ...

Scrideli CA[au] - PubMed Result - NCBI

1: Cruzeiro GAV, Salomão KB, de Biagi CAO Jr, Baumgartner M, Sturm D, Lira RCP, ... de Paula Queiroz RG, Oba-Shinjo SM, Scrideli CA, Nagahashi SMK, Tone LG, Valera ET. ... 2018 Feb;214(2):213-216. doi: 10.1016/j.prp.2017.11.020 .

"Русский Север 2019" - Страница 2 - Клуб Служебного ...

183 Сука Промежуточный gav 9022 ... 214 Кобель Юниоров rbi 01236 ... smk 2 КЛАСС ЧЕМПИОНОВ / champion class 13.РКФ 4374302, dmm 4234 КЛАСС ЧЕМПИОНОВ НКП / club champion class 14., РКФ 4567011, jjg 1968

Питатель пластинчатый СМК-214 в Сибае (Дробильное ...

Питатель пластинчатый СМК-214 износ 5%, 2006г.в., в комплекте питатель, бункер 7м3, редуктор, эл ...

<SEC-DOCUMENT>0000945934-17-000003.txt : 20170301 <SEC ...

<edgarSubmission xmlns="http://www.sec.gov/edgar/seventeenafiler" xmlns:com ="http://www.sec.gov/edgar/common"> ...... &NC#W-!.2&N)!6]+HBG_(SK ...

Property & Casualty Code Lists

... FLO falling objects; FLV fire of vessel; FRZ freezing; GAV general average; GLS glass; GVA government ... SHC sinkhole collapse; SHS shortage/slackage; SKV sinking of the vessel; SMK smoke; STV standing of ... Coverage Code List ( 214).

Клатч SMK(214)-GAV - купить в интернет-магазине Lacywear.ru в ...

Клатч SMK(214)-GAV, материал искусственная кожа, страна Китай, цена 1440.00 руб. Замечательный женский клатч.Размеры: 25*16*3 смЦвет: синий ...

Smk 15 chk teraonline-game.ru

Smk 180 gav Пневматический фильтр GAV FR-180. Фильтр-регулятор FR-180 GAV предназначен для очистки от влаги и пыли сжатого воздуха, поступающего.

Gun Data Codes - State of Michigan

GAV. Armand Mieg. --. MIE. Armas. --. AEI. Armas Bost. SP. BOZ. Armas Erbi. SP. ERI. Armas Gib-Maximo. SP. GIM ...... SMK. Smoker. US. IJ. Model of Iver Johnson. Smythe, John M., Mdes., (or Hdw.) Co. US. SMO. Various mfrs. ...... Page 214 ...

NCBI CDD Conserved Protein Domain PRK09355

Dec 9, 2010 ... ... DELKVITKMANGLLVNIGTLEPYQMESSMISMKIA 75 gi 28211402 6 .[5]. .... FI GAVS 227 gi 25028148 152 ...

Smk 214 gav. <SEC-DOCUMENT>0000945934-17-000003.txt : 20170301 <SEC ...

<edgarSubmission xmlns="http://www.sec.gov/edgar/seventeenafiler" xmlns:com ="http://www.sec.gov/edgar/common"> ...... &NC#W-!.2&N)!6]+HBG_(SK ...

Technical informaTion 2018 - Gestra

SMK 22. Virtually pocket-free. For small and medium condensate flowrates. ...... H1 211 214 220 238 243 266 290 324 348 460 479 570 606 660. GAV 36F.

Стереомикроскоп Альтами СМК1865 (СМК1865-Т) купить по ...

МКАД 38 км, владение 4Б, стр.1, офис 214 +7 (495) 662-96-25: Санкт-Петербург Маршала Говорова д.35, корпус 5, литера Ж, БЦ "Терминал" 2й корпус, 3й этаж, офис 356 +7 (812) 643-23-55 Новосибирск Красный проспект 220/5, офис 320

Smk 129 gav ogup-ivces.ru

Клатч. Замечательный женский клатч. Размеры: 25*16*3 см. Цвет: синий. 1440 RUR. LacyWear SMK(214)-GAV похожие · Подробнее ...

-----BEGIN PRIVACY-ENHANCED MESSAGE----- Proc-Type: 2001 ...

... MESSAGE----- Proc-Type: 2001,MIC-CLEAR Originator-Name: [email protected] www.sec.gov ...... SK#B+R:7YCW2K M-J)%1Y0M`CBW**\RCSBKXW9CPCUN3B .

SMK214.wmv - YouTube

Apr 10, 2012 · Питатель ящичный пластинчатый СМК-214. Skip navigation Sign in. Search. Loading... Close. This video is unavailable. Watch Queue ... SMK214.wmv Евгений КЕМ ...

Smk 214 gav. -----BEGIN PRIVACY-ENHANCED MESSAGE----- Proc-Type: 2001 ...

... MESSAGE----- Proc-Type: 2001,MIC-CLEAR Originator-Name: [email protected] www.sec.gov ...... SK#B+R:7YCW2K M-J)%1Y0M`CBW**\RCSBKXW9CPCUN3B .

Переходник Gav Uni-c2


Тип оснастки: адаптер (переходник), Посадочный размер: 1/4

528 РУБ

Gav uni-c2 похожие

Подробнее

Аэрограф GAV Minipaint50 LVLP, сопло: 0.3 мм, бак: 0.03 л

Пистолет GAV 167 В бс антикор. со шлангом

Краскопульт пневматический GAV Record-2200 HP, сопло: 1.2 мм, бак: 0.6 л

Переходник Gav Uni-b3


Тип оснастки: адаптер (переходник), Посадочный размер: 1/4

660 РУБ

Gav uni-b3 похожие

Подробнее

Виниловый проигрыватель CROSLEY EXECUTIVE [CR6019D-SMK]

Моющий пистолет GAV 61В Быстросъем


Моющий пистолет GAV 61B предназначен для распыления технических жидкостей на различные поверхности. Соединение: Быстросъем Объем бака: 1 литр. Благодаря вместительному баку, необходимость прерывания работы на дозаправку появляется реже. Инструмент обладает большим рабочим ресурсом и способен длительное время работать без остановки. Благодаря удлиненному соплу пистолета GAV 61В очень удобно вести работу в труднодоступных местах Корпус изготовлен из металла, что обеспечивает надежную защиту от ударов и падений

1107 РУБ

GAV похожие

Подробнее

Краскораспылитель GAV RECORD-S 1.5 бс 24552 HP, сопло: мм, макс. 250 л/мин

штуцер GAV ВР 1/4


Тип резьбы: ВР 1/4

117 РУБ

GAV похожие

Подробнее

Краскопульт пневматический Gav 162 А 9716


Пневматический краскопульт GAV 162 А 1.5 бс работает с компрессорами производительностью от 100 до 400 л/мин. Сопло диаметром 1,5 мм подходит для большинства негустых жидкостей. Рабочее давление регулируется от 4 до 8 бар.

1859 РУБ

Gav 162-а-9716 похожие

Подробнее

Переходник GAV UNI/A1, 1/4F


Переходник GAV UNI-A1, быстросъем (мама) с внутренней резьбой F 1/4 - предназначен для соединения элементов пневмолинии. Пропускная способность 1500-2100 л/мин. Рассчитан на давление до 16 бар. Вход: БС, внутренняя резьба Выход: F 1/4 Созданная конструкция обладает высокой надежностью и герметичностью.

427 РУБ

GAV похожие

Подробнее

Продувочный пистоле GAV 60B, Быстросъем


Продувочный пистолет GAV 60B с быстросъемным соединением. Используется для воздушной продувки и очистки разных поверхностей. Расход воздуха: 200 л/мин Давление: 6 бар Соединение: Быстросъемное Удлиненное сопло позволяет работать в труднодоступных местах На корпусе пистолета имеется отверстие для хранения в подвешенном состоянии Пистолет снабжен защитой от защемления пальцев

682 РУБ

GAV похожие

Подробнее

Краскопульт пневматический Gav Record-2200 24541


GAV Record-2200 – профессиональный пневматический краскопульт. Подходит для нанесения краски и лака на деревянные, металлические, пластиковые и другие поверхности. Объём бачка 0,75 л.

6890 РУБ

Gav record-2200-24541 похожие

Подробнее

Переходник GAV UNI/C2, D8 (елочка)


Переходник GAV UNI-C2, быстросъем (мама) с елочкой Ø8 - предназначен для соединения элементов пневмолинии. Пропускная способность 1500-2100 л/мин. Рассчитан на давление до 16 бар. Вход: БС, внутренняя резьба Выход: Елочка Ø8 Созданная конструкция обладает высокой надежностью и герметичностью.

437 РУБ

GAV похожие

Подробнее

Краскопульт пневматический Gav Record-2000 26551


GAV Record-2000 – профессиональный пневматический краскопульт. Подходит для работы с лакокрасочными материалами различного типа. Объем бака 1 л, диаметр сопла 1,8 мм. Рабочее давление 4-8 бар, расход воздуха 150–250 л/мин. Подключение с помощью ЕВРО-адаптера.

13327 РУБ

Gav record-2000-26551 похожие

Подробнее

Комментарии



Подпишитесь на новые товары в motorshowmagazine.ru